DPCstruct | MC11488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 187 ± 27 aa |
| Standard deviation of domain lengths | 26.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1W5E3 | 4-177 | SSVDKVSVPLGATSKFVATETWLIKVTQYTLDIVKQTDCALVATATDSHDLAPTGEDEVQFVNIEVIPSRDDIRRFSFRMSTTALRD… |
| A0A0M3JU48 | 2-204 | TNSWILNVTNYSLICAQVSDVTLEAVRADEHPISHHERSGGPAQFLDIEVRSITKKFEPFIVRIQSGQFQDMRDKLNKPIGLAQQVV… |
| A0A7R8WHA7 | 347-562 | None |
| A0A819CSP8 | 466-696 | None |
| A0A2H1C2M3 | 48-270 | None |
| K7H329 | 107-318 | None |
| A0A0K0E0K8 | 162-357 | None |
| A0A4X3PA09 | 1054-1230 | None |
| A0A7R8D5P1 | 376-576 | None |
| A0A6L2Q1L9 | 135-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.