DPCstruct | MC11485
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349PAQ5 | 27-146 | RIVDDINLPFINDPAVLGEWISVDFVKEPPLFTPGAKIFKKDLYLKGLAFLPNGKILVDNKTDAPWFAWTKGVLMHSGDKTASAYAI… |
| A0A8A7W0M9 | 299-405 | KFVQNPTLSGSWKLVGEVAEIAEFDPEKPRKARNPLLSALTFGEDGKTADPYWQWSGDLLMDLTRYQALRVEPHSIGGQDYLFIEAG… |
| A0A5E4IG41 | 298-412 | None |
| A0A3D1A2M6 | 146-259 | None |
| A0A1F9QRG6 | 144-260 | None |
| A0A037YXF7 | 183-288 | None |
| A0A1V5LWX3 | 175-294 | None |
| A0A351TF71 | 387-517 | None |
| A0A1V6ETQ4 | 1-92 | None |
| A0A847DBL4 | 87-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.