DPCstruct | MC11484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2XRE6 | 2-141 | NQSYVGDECVFEFAMCFECREKMNDKLSEKSRVAMFDFMHDHADMESREEELGTDSATDDYISRCLTCGKSRSEANGYTLGAMFAGD… |
| A0A5S9IJ45 | 48-175 | CECDLVESLTLYQVQKVFRRKRVIFEYALCFQCQQGLAKEYSKESTEKLQNFFLENYIMTEDMHECHLCQSENVEKEHTLLALCLGN… |
| A0A2G6Q4H8 | 25-172 | None |
| A0A517ZDF2 | 26-191 | None |
| A0A3E0PMR6 | 85-241 | None |
| A0A2E3N4W5 | 1-123 | None |
| A0A364XY79 | 17-192 | None |
| A0A2E7DBE9 | 46-205 | None |
| A0A6G6K7N3 | 19-168 | None |
| A0A849WGB4 | 44-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.