DPCstruct | MC1148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136M082 | 1-138 | MPSSLRYMLLLLFLIVLIAGCSAVITSVVLLPSQRTFWQVCQPDEVGFYDAEYCISVVEERTFYQELTGGSTFYLAIAPYEGDPVYS… |
| A0A6N7YYA8 | 35-133 | FTVNVLYEGSSKAAGVTYEYSGSQYASELYLVEVRSLAGTRYELRIGPHAAEEYYPVEVRFGAGEPRIHVVEWRADSVAVTFESGNS… |
| A0A7Y6QK35 | 5-122 | None |
| A0A495XF66 | 1-118 | None |
| A0A6I6ME27 | 1-100 | None |
| A0A068NIJ6 | 2-127 | None |
| A0A5C8K4S7 | 1-105 | None |
| A0A7W8QKA1 | 31-116 | None |
| A0A2Z3HHN8 | 5-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.