DPCstruct | MC11479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 273 ± 49 aa |
| Standard deviation of domain lengths | 48.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7R154 | 14-262 | PGSIKRLRIVQVLPKSTPGINWPPVGIPNASPGKQVLGTVPVELDGSAWFLAPARVPLSLQALDEKGQAVQMMRSIIYLQPGETLSC… |
| A0A7Y2T4T0 | 500-770 | VNDVYQGLLREGVKRGEVKHLRIIEVLTKKQHTQPRRCDVGVNSGWDIRKVLGTVPIENDGSAHFQLPPHKLLLFEALDNDHLEIKR… |
| A0A0S8E0B9 | 4-199 | None |
| A0A7V6HJB2 | 680-958 | None |
| A0A7X7FD73 | 36-308 | None |
| A0A7X7TZH1 | 248-626 | None |
| R7LCZ0 | 32-299 | None |
| A0A1G1A9R4 | 908-1167 | None |
| A0A832HAD8 | 558-783 | None |
| A0A0S8EPZ9 | 575-831 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.