DPCstruct | MC11477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1CSR9 | 103-161 | VAPPDRQRSRDLPYAVRVPNRPGLVTSPYAPDEGYVDVSEFPSSTEVMDPFTGKIFLTP |
| A0A354TCG9 | 9-71 | ANTPAVTPAPNPVTELPYGTSISGRPGFVNSPFAAKHQLVDVTGLPVGMEVKCPYTGKLFRVP |
| A0A2V6B0C8 | 109-170 | None |
| A0A366HQL2 | 214-287 | None |
| A0A4Q2Y9T2 | 128-190 | None |
| A0A838DHR3 | 1-52 | None |
| A0A7W7YDY9 | 148-212 | None |
| A0A4V3FFL0 | 190-253 | None |
| A0A2V5RYU5 | 1-62 | None |
| A0A2V5V0N7 | 173-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.