DPCstruct | MC11476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 148 ± 19 aa |
| Standard deviation of domain lengths | 19.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4FTI0 | 106-238 | KLESEYASLERAIGGMKRSQGSSEDETSTTAWDGFFDNKGALRYIREVTDYGDKGRINFQYAYRDGKPMAVVQERVPAMAEKPNAVT… |
| A0A7Y1UEG2 | 13-159 | AILPATAGAQQDTAHHRAAYAEINDNQKSYRYVKATLDDEHAEVKIEGWYDGRTLRKILATIPGEHGLGVEEYYLEAGAPLFVYTKY… |
| F4KY98 | 44-202 | None |
| A0A1G9Z6J9 | 1-115 | None |
| A0A1Q3N3V6 | 47-177 | None |
| A0A2N5YU46 | 1-119 | None |
| A0A2N5YU39 | 170-285 | None |
| A0A3A9A0N8 | 71-217 | None |
| A0A425YF88 | 24-174 | None |
| A0A848WQE1 | 141-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.