DPCstruct | MC11475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5X5N0 | 5-80 | YRSPKNPNSHLTAKRRKQPSYPTRFLLEHGYVRGKVLDFGSGLGADARYLRKLGYDVTEYDPYYAPEYPSCRFDTI |
| A0A533Q6A8 | 1-76 | MIIPRHRTAIPRNKFSLPIKLALRDQIINSSSTVFDYGCGKGTDVALLKQKGIKCSGWDPAEGSEKPCITVDVVNL |
| A0A6M1LU49 | 24-107 | None |
| C4ZPL0 | 179-254 | None |
| A0A0F0EBD7 | 183-266 | None |
| A0A8A9ES32 | 110-183 | None |
| A0A7X8XNF5 | 4-87 | None |
| A0A6B0YI40 | 1-82 | None |
| A0A5S4FPL9 | 3-75 | None |
| A0A850SZ73 | 194-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.