DPCstruct | MC11474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 95 ± 16 aa |
| Standard deviation of domain lengths | 16.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.99 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 64.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0385 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N2M566 | 1-100 | MASGQERSELDSRARQGETVIPGGTGGKSLEAQEHLAQGRSRGGQTRKDQLGHEGYQEIGSKGGQTRKEQIGHEGYQEMGRKGGLGA… |
| C6T0L2 | 2-91 | ASHQQNKQELDERARQGETVVPGGTGGKSLEAQQHLAEGRSRGGKTRKEQLGTEGYHEMGRKGGLSTMDKSGEERAQEEAIDIDESK… |
| A0A4Y1RPW0 | 88-205 | None |
| A0A2H5NJU2 | 44-150 | None |
| F6H6R9 | 1-111 | None |
| A0A7I4CCG5 | 1-77 | None |
| A0A388LCC5 | 11-82 | None |
| A0A3S3P0G4 | 1-97 | None |
| A0A1Y1HJF5 | 20-111 | None |
| A0A314YVH9 | 11-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.