DPCstruct | MC11472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445BRU5 | 21-142 | VEVENRREVRLQPGAEEKLVLQFMDSLNSYLSLSHSLSSTLGQAWMELASARHSMGTARLNTSLLDLKFHPASTTLKITEYDVDLVD… |
| A0A368UGG6 | 1-127 | MEKINKLQHQCQVPRAEEKFVLQFMDSMDNYLSLFDAVSSTLRQGWFDLASARHSMGASRINSSLLDLKFHSAATTLKITNYDGTQP… |
| A0A6A1UWR5 | 35-187 | None |
| A0A5C7IVJ2 | 177-305 | None |
| A0A1P8ASF3 | 1-133 | None |
| U5D9X3 | 1-113 | None |
| A0A498KHH7 | 41-183 | None |
| A0A7J9DFY6 | 143-262 | None |
| A0A6N2LFY5 | 11-139 | None |
| A0A6A3AMS1 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.