DPCstruct | MC11471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 134 ± 34 aa |
| Standard deviation of domain lengths | 33.78 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 73.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2NYB0 | 1-99 | MSEYNILSLLQQMTMVSNVYKTQNQNGLISDHAIANLLVAGFTGQLKGWWDNALIKTQQEEILKAIKKDDQGRIILNEQGREIQDAV… |
| A0A0R0L8L3 | 194-299 | QMEYNIMNTLQHMTMVATAYQTSHECSKETIIDILVTGLSGQLKGWWDNYLTNEEKSKIYSAVNTDLNGKVITNDEDKEIPDTVNTL… |
| A0A1U8F385 | 57-238 | None |
| A0A1U8F121 | 51-226 | None |
| A0A1U7YD81 | 9-109 | None |
| A0A7N0TK87 | 1-82 | None |
| A0A6J5VF30 | 51-239 | None |
| A0A5A7TEB7 | 100-263 | None |
| A0A1Q3DBK8 | 1-111 | None |
| A0A1U8EBF5 | 177-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.