DPCstruct | MC11470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 305 ± 67 aa |
| Standard deviation of domain lengths | 67.14 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9D3F1 | 2-245 | PNYLRELNEQLEENLGYQLPVDFVPVRFTSWMGGDRDGNPNVTSDITRHVLLLSRWKATDLFLKDIQLLISELSMVECTDELREMAG… |
| A0A0R0KW91 | 54-364 | ACNMRQAGMEDLAEMLEKQLASEEVEIVLTAHPTQINHRTLQYKHLKIAVGEKTSIWQTDELRRSKPTPVDEARAAVPHYLRRVSSA… |
| A0A820UCH0 | 1-373 | None |
| A0A287RAD5 | 4-277 | None |
| A0A446U7E8 | 77-432 | None |
| A0A656H776 | 1-210 | None |
| A0A1E1F3J4 | 105-426 | None |
| Q74J38 | 95-442 | None |
| U1PTE3 | 112-460 | None |
| A0A2V5ASP8 | 59-409 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.