DPCstruct | MC11467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07007 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3DEV2 | 121-209 | NRNDIKPSFDCGKAQAESEKAICADYRLSSLDKSVFDAWRVAKALAEDVANTELLATVVASQKAWLMNRNQCGSDPQCLAKSMTERM… |
| G3A648 | 5-102 | ALAALTITLSTAAIAGPSFNCAKASSNVEKMICADQTLSDADSVIGDMYKEVLSTTDNPNRVKQEQRQWLTKVRNVCTTPDCLAKAY… |
| A6Q7A7 | 4-89 | None |
| A0A6J5D1U6 | 9-125 | None |
| A0A839LUT8 | 164-274 | None |
| A0A7W9WTK6 | 1-122 | None |
| A0A6G9QHD1 | 5-110 | None |
| A0A2N7WTU6 | 2-109 | None |
| A0A522KMD5 | 257-366 | None |
| A0A562QZ37 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.