DPCstruct | MC11465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 170 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2PKP9 | 11-170 | RVAFAAGVMVMLVSALWAGLLRIGWALPFSPIALAALHGQLFVGGMLGTVIGLERAVAIGRPWAFAGPLLTLSGGLGLLLGLPTTLG… |
| G3A3N1 | 2-192 | AAVMLVAGIAGGLARVGVVVSAVAGTQWLGYAVLNHAALMICGFLCTVIAIERAVAVKSRMAFLAPMLSGTSGLCLLFGWAEVGAWL… |
| K4QT66 | 48-210 | None |
| A0A399YZR5 | 17-177 | None |
| A0A2U1S2R2 | 176-335 | None |
| A0A1Q9UH07 | 2-181 | None |
| B9TAL7 | 13-172 | None |
| A0A2D6MRS9 | 139-308 | None |
| A0A239IGF5 | 29-224 | None |
| A0A062VRV7 | 240-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.