DPCstruct | MC11463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0IUF6 | 142-261 | EKRIWSPYIDNIELLYEHRNEILAHKEWAMATIPLKVYMVCQPICIGTMLRLWANENEWLTYQCECGHKAFIYSFAGSPLSGTTSIS… |
| A0A2T5CHF8 | 4-148 | KSQHHERDEYFRKIAQKRERELELIREHLGLFIENTDFILSRPEYFNITSDAAYLGLMVGFYWRIPLGVLLMLWQEQKMIATCPKCQ… |
| A0A2N1RNX5 | 28-203 | None |
| A0A2E7CJ37 | 104-222 | None |
| A0A432PZ14 | 17-188 | None |
| D9S474 | 19-164 | None |
| A0A1W9VLY6 | 4-136 | None |
| A0A7V7MYH0 | 74-194 | None |
| R6HRT5 | 17-132 | None |
| A0A1M6TKG4 | 62-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.