DPCstruct | MC11461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 245 ± 19 aa |
| Standard deviation of domain lengths | 19.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016EC98 | 1-254 | MPYQLFDYPQKLGVKALYFPWNGDSRESEYGHFIYEDLGYINEAQRWEFEAMVVWGETAPHLLNLARYNIVNKRPEVARRFINLLKQ… |
| R7JGN7 | 97-348 | TMFDYQFRGPQALAVNWNHTEDVSVLLSDIYFTAGNIALSQRLAFEGNSCARGNYNARLLQRLVQTNLIYGEYAVAEKYIRLLEKSW… |
| A0A3D4EB20 | 2-243 | None |
| A0A6F9Z7U2 | 349-590 | None |
| A0A3N5H3T4 | 80-328 | None |
| A0A3B8ZQP8 | 1-218 | None |
| A0A353E4Q9 | 228-468 | None |
| A0A7X9D6C6 | 131-354 | None |
| A0A389M062 | 1-293 | None |
| A0A3D2Z842 | 216-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.