DPCstruct | MC1146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 315 ± 35 aa |
| Standard deviation of domain lengths | 34.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P9EVF6 | 10-303 | RPSYLDLAPSDPLLARLLALYTWFLPSLDWRDRQRVESAGVSFRNEWGRLLPDERDRAVDVLVGRWCAFKADARSLDPAELGYQKMC… |
| A0A0P9EK57 | 5-328 | LDAVAALLSSRATSLYHWLQLHAPSRSDTLSDPTKSREALINNSLTGAGTRFAQNWYELLPWQRERVVDRLLAAYCTTRTPHEDFLW… |
| A0A0P9GJF7 | 20-312 | None |
| A0A5C5FP18 | 1-338 | None |
| A0A5C5FM99 | 8-387 | None |
| A0A5C5FL17 | 8-261 | None |
| A0A0P9FEB3 | 24-365 | None |
| A0A0P9EKF8 | 6-285 | None |
| A0A0P9EK68 | 14-349 | None |
| A0A0P9FE72 | 5-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.