DPCstruct | MC11458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05666 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B7PVE5 | 2-96 | AKTTGSVFSPKKGVICDTYICADQKGVSKPLTARYLGKAKANRAFSQGSFDATAFTLSNGVFCDTKTKLCHADRYFDQNGKRSKVDK… |
| D2TVR8 | 15-121 | SVILFFYSAFTLAISSKLLISPEPSVLCDRYICVDSITGVSVSLTEKYLGKKQANRLLSQGLFDKTAFTFDNGVFCDIKERKCYIDR… |
| A0A485CXN1 | 1-109 | None |
| A0A151CDX5 | 24-133 | None |
| A0A4P5VJN7 | 14-106 | None |
| A0A2S4RXL3 | 24-117 | None |
| A0A376DE73 | 11-138 | None |
| A0A326QCG3 | 35-141 | None |
| A0A151CDX0 | 106-204 | None |
| A0A523K6Z9 | 28-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.