DPCstruct | MC11457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 152 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2HLI9 | 1-140 | ELLQAMVVSSGGTPYPVKALIQMAKDITTGLGGYIQDGKTATGALRSWSVALSNYGAKSGNGHIAVLLSTDELSGAAEDTDRLYRFQ… |
| A0A1U9XEX6 | 1-168 | MRSVASMIEGLGGYINSSKQAIGAGGGWSDTPSNYGLNCATGHIAMALVGADLQESDRLYRYSITNRPDLNRMHTAIDMNSNNLNNV… |
| A0A2E6KNE2 | 119-284 | None |
| A0A1A9VZ53 | 18-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.