DPCstruct | MC11455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 200 ± 29 aa |
| Standard deviation of domain lengths | 28.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U9LQT8 | 56-239 | YHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEI… |
| A0A4P7KUL0 | 7-193 | HQQQAKFAKLLATLELGEFQSTFQTAITQGFSKKKLIDFSSQNKLTDIFNNKLEPYTESGVTGYRLTADYTQQLLQAYNLSTADKTT… |
| A0A379WRL9 | 1-147 | None |
| A0A4Q1BES1 | 30-216 | None |
| D2T7E2 | 234-431 | None |
| E0WT68 | 430-623 | None |
| A0A376SRC2 | 4-164 | None |
| V2JI36 | 687-890 | None |
| A0A1X1EG47 | 77-344 | None |
| A0A839K9H3 | 2-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.