DPCstruct | MC11453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 74 ± 12 aa |
| Standard deviation of domain lengths | 12.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 80.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804RMR8 | 190-244 | AYLSYSLGALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRL |
| A0A830BM58 | 1-66 | YLSYSLGALAVFGSIACCFAWFNNTAYPREFYGLTGPEAYQAQAFTFLVRDQRLGANVGSAQGPTG |
| A0A287I632 | 114-200 | None |
| A0A4V6T3X7 | 38-101 | None |
| A0A830CFG7 | 52-112 | None |
| A0A3P6DE01 | 38-114 | None |
| A0A7J6DTD7 | 175-265 | None |
| K3XT18 | 9-96 | None |
| A0A7S0CKW5 | 180-266 | None |
| A0A2J6MER3 | 187-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.