DPCstruct | MC11451
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 13.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0IWA3 | 17-140 | FKYILNELRGIKVVERSNRELVIDILQSMVEIVTYGDKHDPIIFEYFMEYQVMAEFVRVLKISKNSRIEAPLLQYLSIMIQNIESDH… |
| A0A830BI18 | 7-120 | KSRDRYSLDELRFLIDQLMKVQIVNEVNKDFVIEALRSVSELITYGDQHDAAYFECDINASLFFMEKQVMGEFVRILRISRTLIVSL… |
| A0A7J6RXZ9 | 15-150 | None |
| A0A369RY95 | 5-127 | None |
| A0A5E4PUR1 | 9-138 | None |
| A0A1I8I5L0 | 16-152 | None |
| A0A6P8I7U2 | 8-148 | None |
| A0A226EV27 | 180-315 | None |
| A0A812N184 | 11-133 | None |
| A0A7J8IXU0 | 16-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.