DPCstruct | MC11449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 70.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B2Q9C8 | 298-371 | LGAAGIFIPEFLTKIGVLNTPSWYSAGELEYFTDTTTLFIVELFFIGWAEGRRWADIIKPGCVNTDPIFPNNKL |
| A0A7J8LER6 | 1-80 | MLGAAGIFIPEFLTKIGILNTPSWYSAGTEEYFTDTTTLFIVELIFIGWAEGRRWADILKPGCVNTDPIFPNNKLTGTDV |
| A0A287HQ72 | 1-75 | None |
| A0A427A5I1 | 222-309 | None |
| A0A498ICN2 | 178-264 | None |
| A0A6L2NNJ5 | 325-412 | None |
| A0A7I4ENA8 | 1-75 | None |
| A0A0D2PMZ6 | 39-126 | None |
| N1QZX5 | 92-179 | None |
| A0A835HXL4 | 440-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.