DPCstruct | MC11445
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 15.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 63.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A232FE89 | 1-123 | MKEKIAVQYLKREERKLGLEEKPLLVQLNWHIDDREGRFLLRRIDDKTNAQGVGFAEASSFRRKLSKREKKQMKKQEKLSRLKSAGA… |
| A0A7T8HKU2 | 50-152 | VPEYALYEIHESGERRLNPEEKPLLVQLNWHKDDREGRFLLRRIDEASRMPEPTKEDSSFKRKLSKREKKQLKKQGKINKVKDKENA… |
| A0A7E4RUB5 | 173-313 | None |
| A0A6I9YDU6 | 91-202 | None |
| A0A212C7P3 | 1-117 | None |
| A0A060Y8N4 | 41-191 | None |
| A0A1B0CFZ8 | 83-217 | None |
| A0A6A4X000 | 81-219 | None |
| A0A077ZCJ2 | 85-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.