DPCstruct | MC11442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 39.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8L6L2 | 59-191 | IQMTVSVPGIVNEGVPTQTVFPLYILLARLVSDVAVAEYSAVYRFRRACILTSFTGIDDSNQAQVNFILPEINKLAMEAKSGSLAIL… |
| A0A6L5BCR5 | 1-165 | MADTQHSEVYHYSRMGVLSNYMGRENLSQSHVWFYLPRMEKLSAVIEDSPVSVLLVSCGRLVSDDDSTLDHTDKTAFPCTGGNVLVG… |
| A0A835R5K0 | 210-362 | None |
| A0A452XBA4 | 1-144 | None |
| A0A452XB97 | 1-155 | None |
| A0A811NRN0 | 37-189 | None |
| A0A453A6F3 | 2-148 | None |
| A0A4D6FTI9 | 79-260 | None |
| A0A452XBB4 | 3-123 | None |
| G7I2Z7 | 66-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.