DPCstruct | MC11441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 124 ± 16 aa |
| Standard deviation of domain lengths | 16.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 65.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 56.62 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | CL0065- PF06708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5B8H0 | 18-143 | KLWALIIILILAFWSMFTGSVTLNWSTAATTLTDDFYYPLHSDLDILEVEDREKLVRRMWDVYTHSKTIKFPRFWQRAFEAAYEDLT… |
| A0A6P6AVV4 | 5-101 | KGDITEADIEKELEEREKVVRKMWDVYTHSASARLPRFWLEAFEAAYEYLSSDVPGVRETAMSEIAKLSMPSLNLDSASAQSKSSSR… |
| A0A151TZ30 | 9-129 | None |
| A0A2N9GMN0 | 34-157 | None |
| M4D5E1 | 17-148 | None |
| A0A0D3D8E1 | 37-155 | None |
| A0A4Y7J5T8 | 42-170 | None |
| A0A6S7N0R0 | 145-236 | None |
| A0A199VV26 | 65-198 | None |
| M1A2H8 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.