DPCstruct | MC11440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7WDA6 | 1-129 | MRAFLLSFAVMLAVPQADAAINISVDANGNRHAIDPRIYGVAWANAAAITDLSIPLNRWGGNAMSRYNWAFSTANRCKDYYFFNIPD… |
| A0A4S4NBH6 | 247-345 | ERIYGVNFPTDADYISHLGVTISRKGGNAETAYNPFGDFTNAGNDWYFENRAADDADEWLEWVQGADSQAILLIPALDWVSKDATSY… |
| A0A538A5D3 | 9-141 | None |
| A0A1V5LUZ7 | 3-162 | None |
| A0A5C3LAJ6 | 275-377 | None |
| A0A7C6EJI2 | 3-133 | None |
| A0A2V8NTE3 | 3-153 | None |
| K5XGR9 | 278-382 | None |
| A0A1W4XJ52 | 1-143 | None |
| W7SRG6 | 59-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.