DPCstruct | MC1144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 123 ± 30 aa |
| Standard deviation of domain lengths | 30.11 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 88.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6C8K3 | 13-94 | IRYHEVEKGTYCPDCFHKLEKSSERKYQCTQCDKIFTSRMIIEESCKDLPILFPNIVITTPLLYDWFGGQMSDHNLRRYLKM |
| A0A6M0Q6M6 | 43-181 | FINKLEALERLYQNESVNSRELKKLTKLLLANNQEGNPDVLSQFNISKDSLIEGVQCPNCFSIPMLRKYNKWFCPQCSNVSKDAHIP… |
| A0A328A8P5 | 15-114 | None |
| A0A846TM42 | 12-123 | None |
| A0A2N5FFH0 | 84-221 | None |
| A0A366JT82 | 1-81 | None |
| A0A839A5X5 | 97-253 | None |
| A0A1V3G5N0 | 1-76 | None |
| A0A0M4GDN3 | 132-210 | None |
| A0A0M2SUU4 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.