DPCstruct | MC11436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 710 |
|---|---|
| Mean domain length (aa) | 130 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.56 |
| Pfam Score | 94.43 |
| Assigned Pfam label(s) | CL0276- CL0042- PF01062- CL0265- CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523YWR3 | 4-100 | VFERIINRQLPAKIFFEDDQVIVIADHYPRTPVHLLIIPKLVTKNFYEAPPETLNMLNKYAKMIAEKLGITDHFRVIINNGYGQEID… |
| A0A6I2FES2 | 18-135 | CAAPHKSDEDGLIVHRGRTAFVLLNLFPYNSGHLLVCPYRHVATYDEATAEEVEEIGILTQHAMRVLRDVSRCDGFNIGMNQGRVAG… |
| A0A1I6D238 | 50-186 | None |
| A0A0P1AX20 | 625-744 | None |
| A0A2G6YW46 | 26-154 | None |
| A0A4Z0YTK4 | 535-680 | None |
| A0A7R9U1I6 | 37-174 | None |
| A0A496TA51 | 61-217 | None |
| A0A7S2SCH0 | 262-397 | None |
| A0A2H3GV46 | 675-778 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.