DPCstruct | MC11435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A173LIB7 | 261-343 | GAKGVDNLNELDCSDGRIYANVWMTDRIVRIDPSSGEVDAQWDLGELQQPRPSDPDAVLNGIAKVPGSDTFIVTGKLWPNMYE |
| A0A1W6ED94 | 3-86 | NLNELEYINGYVLANVWQTNRIVQIDLATGNVVGDLSMEAILPAGLNTKENVLNGIAYRPDEGALYVTGKNWPSLFKLQVSDLQ |
| A0A1D6LJ68 | 8-101 | None |
| A0A2E4C709 | 253-339 | None |
| B5Y5L7 | 527-608 | None |
| A0A7V9GCH4 | 12-105 | None |
| A0A7V5U9W4 | 426-521 | None |
| A0A163L9L7 | 176-271 | None |
| A0A7S1JJP6 | 115-208 | None |
| A7BTW1 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.