DPCstruct | MC11434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 350 ± 48 aa |
| Standard deviation of domain lengths | 48.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 20.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811YUU0 | 4-335 | TLPFYVCPGNHRDRRLNPTCGGGEYFYCKNWGCETTGDTEWRPSSSWDYITVKANYTHPTFSKWKTLNYGPCQGWCHPLRISFTEPG… |
| A0A671G6E5 | 51-359 | GFWACPGNLRNNWKTCGGPDRYYCGSWSCVTSYDGPRQWDVGNRDLVKFSFRDPHNRVPQVRVQFNQDVARRERGWLSGLTWGFQLD… |
| A0A4X2JLX4 | 34-412 | None |
| A0A3B4EPC0 | 2-317 | None |
| Q8BI48 | 53-421 | None |
| A0A3Q3XF83 | 2-327 | None |
| A0A6P6BSK0 | 3-385 | None |
| W5PRK2 | 159-499 | None |
| W5PXG5 | 1-251 | None |
| A0A674GTV4 | 101-467 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.