DPCstruct | MC11433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A554MJZ8 | 2-83 | TQKWFKAKEYGWGWYPVTWQGWTVTLGYVLLAVLFAFTLDKNSPPEEIVFTFLLPVALLTATLIRIAYVKGEKPSWQWGKKK |
| A0A0Q4KXM5 | 12-87 | RPGYWFVPHAYGFGATPATVMGWVATALYLIAIGVAVRTMPTDGARMALGAGITTGYLFVIAIKTDGGLGWRWGGK |
| A0A554JAY2 | 3-84 | None |
| A0A7C7M8V3 | 4-90 | None |
| A0A0G1UQP1 | 14-105 | None |
| A0A7L8U4U7 | 2-75 | None |
| A0A2J0Q757 | 52-136 | None |
| A0A1A7BZW7 | 1-84 | None |
| A0A2H0UFI0 | 14-103 | None |
| A0A7X7T243 | 11-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.