DPCstruct | MC1143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 136 ± 15 aa |
| Standard deviation of domain lengths | 15.26 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10612 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A073K1C4 | 12-183 | NCVCEVVRFINELQDSITDNCLTGCDTPFLGGNCNTPFANTRPFVVFDKSGDLFVPASCYSVPGLSVPLPSPLLRVESADDCCAVLR… |
| A0A6M0Q2H0 | 6-143 | DDFDFNCVCKAVQNIKDLQDAVEDNCPTSCFSDLLSPANFVGDTIPFLLYTKKGDLFKAFGNIGELRGGECFKTPFFRVEGIDGCCA… |
| A0A7V6QRW0 | 56-201 | None |
| V6T3N0 | 115-250 | None |
| R5M3C0 | 4-131 | None |
| A0A6N9Q5T3 | 25-153 | None |
| A0A7X9LX48 | 23-172 | None |
| A0A3R9QJ74 | 263-378 | None |
| A0A852TDY1 | 1-123 | None |
| Q08312 | 4-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.