DPCstruct | MC11429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8MK84 | 21-141 | DVAEYWEKAETQLLEELSAGQVLRTPVSLIYHDIDDVNEKLRLGRYFFMDILREGIVLFDEVGFPFVEPQPLSPEQALQETRDYYEE… |
| W6RB65 | 1-95 | MSFIVHSRREVNAYLKEGQYFFADIRKEGIVLYELDDEPLAEPKPLSPADQLRVASEHYVDRFSLARTFLKGCRFYVPEQELRVAAF… |
| A0A1I7DWH1 | 3-87 | None |
| A0A6I0DIJ2 | 9-111 | None |
| A0A7Y8F6Z3 | 16-117 | None |
| A0A7X5Y1U2 | 32-115 | None |
| A0A1G4UA67 | 4-104 | None |
| A0A4R2C3P1 | 3-103 | None |
| A0A3B0XBR3 | 52-153 | None |
| A0A6N8JIQ6 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.