DPCstruct | MC11428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 378 ± 61 aa |
| Standard deviation of domain lengths | 61.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 20.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0F0E3 | 796-1258 | THDDAFHAWTADYLNGRDSVMLAANHTTVTALNARARADRLARDGTQPGATCLLIDGLEASVGDAIRTRHNDPQLRLGPRDWVRNGY… |
| A0A7W1Q056 | 2-336 | QQQLGRDDRDQQRWGQERVLPAEYVQTSVELAYASTVHAALGRTVDTSHALVDAAMDRVAFYVALTPGMLDNVAYVILGGPEEHRLS… |
| A0A1Y6FMY0 | 6-387 | None |
| A0A2H1KPL7 | 283-611 | None |
| A0A1M3J2B0 | 148-537 | None |
| A0A6P0GZH9 | 27-439 | None |
| A0A5R4SGZ3 | 60-408 | None |
| A0A5Q2W236 | 457-860 | None |
| A0A7X7D8X4 | 55-427 | None |
| A0A543FTG5 | 143-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.