DPCstruct | MC11423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0XNJ7 | 43-125 | SSSSNQAEVVTHDVSPTSTHSSPLISARKPPGWPIQFFIRIDLGVSFHTYPPLGGPFRSSEEAEKAIKSHLDGLRSPIMCRDG |
| Q6Z5D1 | 1-120 | MDSWHLYAKEGHVPSSITATSSSSQQADAVDQDTEVWPPSASCLSSSPASRVWARHVKDWGRIFYIRVDLQGSFHTYPNVGGPFQSS… |
| A0A4U6UVM3 | 29-123 | None |
| A0A453RLA7 | 29-145 | None |
| K3Y1S8 | 164-273 | None |
| C5Z3E3 | 28-119 | None |
| A0A287Q877 | 80-180 | None |
| A0A287Q807 | 1-73 | None |
| A0A287JQ56 | 1-105 | None |
| A0A287Q813 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.