DPCstruct | MC11420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6QZN2 | 177-290 | AHAVRQWLSSAEKRLVDVHSEMELLRQESKDLISDESPWSLDIYSITKRGAKSLRWRMTGGAHSRWEKIVPLLAYLAPASAQWYREA… |
| A0A0A0DP38 | 2-103 | AEARLADVHRQMNELRDETKAVEKRRVSLDVYFLRHRLQQSLRWRLAGGKHATWELVKPLLQTMNASEAQAYFEWNSRAEILNALEQ… |
| A0A849SVG4 | 14-127 | None |
| D4X4D2 | 294-405 | None |
| A0A1Q3WP06 | 11-118 | None |
| I2JIP4 | 18-156 | None |
| A0A5C7S1C9 | 2-94 | None |
| A0A1Y1J273 | 2-94 | None |
| A0A0K1NC58 | 25-150 | None |
| A0A7Y5DU80 | 12-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.