DPCstruct | MC1142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 14.73 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9C8K4 | 16-116 | PGERPVLQLLVDLCLRDEGRVSVWDGEEFSVQGCNSKDNILKNLAQTDMDQLEAFDKDGNYLGFFLLIYNNGSEGEPMVVISDYSSN… |
| A0A8A8MFZ1 | 50-156 | RAMVERTIVACAVASFLGAGHVVRLHDGQRWATPLTSRLDVIMAPLMATGEETLYVRSRDGEGCVGAIRFIYGDRGWNVLGEYDDEL… |
| A0A5Q0M6Z2 | 14-133 | None |
| A0A1B8TCM9 | 55-187 | None |
| A0A2E5W5T8 | 61-153 | None |
| A0A846V7T5 | 117-216 | None |
| A0A1H8WSD6 | 14-115 | None |
| A0A646NZ30 | 2-106 | None |
| A0A1I3RPF4 | 15-130 | None |
| A0A1L3SXR4 | 5-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.