DPCstruct | MC11417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 201 ± 59 aa |
| Standard deviation of domain lengths | 58.53 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 72.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q58300 | 17-136 | MKNDDAIKVLSNELLKGAKMLSTHCSKCGCPLFEKDGKIYCPICEKLKNKETIEKGENEKEIKNEIERKKSEINEILDLNKVVMDKI… |
| A0A3P9NMS2 | 11-186 | EWEPPTEAEMKVIQARRERQDKISKLMGDYLLKGYKMLGDCCEACGVSRTGPDFKSCVMRGDWIWNVSSDISPALTSSAKISFSRSS… |
| A0A5B8MCQ8 | 34-272 | None |
| A0A061DAR7 | 1-187 | None |
| A0A177WIK9 | 46-219 | None |
| A0A0N5CYD2 | 6-182 | None |
| A0A819QWC8 | 107-244 | None |
| A0A1V9Z6S4 | 277-456 | None |
| A0A146K8F9 | 68-242 | None |
| T1ELI5 | 31-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.