DPCstruct | MC11413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820LQE4 | 7-91 | KTLDFRVLLIQLSNQLSNDSREGLHFVIGPMVPRKIRDDCTPTGTLHLLEFLFDRTLISDKNFDYLICAFRKISCYDAVERLQGS |
| A0A816GLC9 | 94-197 | MDQQFDFRALLVKLQDCLSDNDRRRLHFIVGDTIPRQLRDDPSLGGTLNLLETLFDQAKISEQDFNYLIQIFREIHCYEGVRRLQEY… |
| A0A818SPB6 | 2-121 | None |
| A0A816MJ78 | 7-121 | None |
| A0A817TH81 | 1-104 | None |
| A0A817D561 | 36-148 | None |
| A0A816CDM7 | 7-95 | None |
| A0A818JI35 | 3-116 | None |
| A0A815P8Q9 | 30-161 | None |
| A0A818H242 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.