DPCstruct | MC11410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 141 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | CL0448- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816G7R1 | 2-123 | KEEVTIKILDEYYAHIDKYRHICKHKSRTRLFILAFLNGPEAVVEIGMNDWFRHGKEINKRNEIIINKTLQEYWIKPEQVELATIID… |
| A0A834A031 | 112-239 | NMESVHMKVEEKITLTCGRDGGLQNMELHGMIMLRISDDKFGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVN… |
| A0A842YQL7 | 3-112 | None |
| A0A2P6NJ18 | 167-324 | None |
| A0A1V9ZPX2 | 928-1075 | None |
| A0A813FGT3 | 374-515 | None |
| A0A2H5P4M2 | 51-254 | None |
| A0A5E4ABN6 | 134-309 | None |
| A0A3P7IFW0 | 17-162 | None |
| A0A817LDB5 | 458-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.