DPCstruct | MC1141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.27 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF15584- PF18426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9DHI4 | 249-426 | TTLREGRRQLNGWEGEEILTRRPEYKDDTDAHEFRFFSVGQRHDALHPLLDIRMDTGVKENARASVRPSLTDEAALALWDKLLPTIR… |
| A0A8A8M7J2 | 1-131 | MNSGEEIPVEGIWEPWFPGDEVGCPNYFLKGSIAHQYLLEGTNDEYDVRWRLLWEDTRYQGGSIPEEESTYFPKPVAETSLRALPGE… |
| A0A375C5Q8 | 1-179 | None |
| A0A0M4LDX1 | 105-238 | None |
| A2W084 | 429-576 | None |
| A0A7U5XV98 | 2-177 | None |
| A0A4R6DWI8 | 331-443 | None |
| A0A4R6DWG6 | 181-316 | None |
| A0A2V4UQF7 | 176-303 | None |
| A0A2G8TF23 | 163-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.