DPCstruct | MC11409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 290 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0409- CL0229- CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821A247 | 1-325 | MANYVSITPPTRANIVSDHKYRLRYFKTPAWCPYCEDYIWGSGNIGYQCTNCGDYFHVECTLVLTSGTCPGLNACHVNNQNLTTYDT… |
| A0A816FT39 | 1-316 | MANYVSITSPHRETIVSDHKYRLRYFKTPAWCPYCEDYIWGSGNIGYQCTNCGDYFHVECTLVLTTGSCPGLSACHPNNRALVTHDS… |
| A0A6P9A5C6 | 16-296 | None |
| A0A2G8LD74 | 80-326 | None |
| W6UKD3 | 4-266 | None |
| A0A4Y5MZ31 | 86-391 | None |
| F2U9R0 | 62-393 | None |
| A0A6S7IWL5 | 1-263 | None |
| A0A0L8G4N5 | 1-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.