DPCstruct | MC11407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 95.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DJW5 | 59-149 | NYHQGPEWVWVVGFYLRARLAVGSILGGSHLELAMKEVQSRLGNYYRHITSSPWSSLPELTNSNGSHCSGSCPAQAWSVGCILEACL… |
| A0A816FHQ9 | 5-92 | GPEWLWLTGYYIRAKLYWAKQQNDPLIIEQTKKHIEEILCSHKELILSNDWKGLPELTNADGKLCSHSCSVQAWSSATLLEALYDLTQ |
| A0A0B1TUK7 | 594-684 | None |
| G2XQH4 | 130-218 | None |
| A0A3P7EBP6 | 2-84 | None |
| A0A0R3S651 | 742-836 | None |
| C9SJ23 | 625-717 | None |
| A0A194RDL0 | 241-329 | None |
| A0A437BA97 | 279-365 | None |
| D6X0Q2 | 60-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.