DPCstruct | MC11406
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816F8B8 | 13-102 | KEGESDCDESDVNSSEDEGDTPMVEVNGKSEFNAMRVFDIVSPSLSNSYFRVEINGKEKYIHKQTAGWFFTNYKPQLSADRSKRAIQ… |
| A0A818AKI8 | 104-204 | DGDDTTNDLNMNEDNDDSSINNDYTDEDEQNNTQDLINTPEKDFSRVKVADKVEPQIEHTYFKVKLNHDTQFLHKQTASWLLTEEKS… |
| A0A820JAV6 | 36-139 | None |
| A0A820JMK8 | 2-86 | None |
| A0A820A9J0 | 132-226 | None |
| A0A821RLV2 | 18-133 | None |
| A0A817MK40 | 1-93 | None |
| A0A821JTX5 | 48-146 | None |
| A0A815LE25 | 338-443 | None |
| A0A815QDG8 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.