DPCstruct | MC11405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 241 ± 67 aa |
| Standard deviation of domain lengths | 67.39 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 75.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813TFV5 | 1-180 | MGTLVFQALSTLCVLVDQTILNRLIQFNSTQYISASVTPSNVFQLQTDAFISQFISSTTNEFLLSLAMIRKTTQSNALVSGQFTNYR… |
| A0A816ESX4 | 358-705 | IYNLRRLNLFKSINRRTPDDIKLQQAATWVYLILLARFRIVDWYGFRGRHFRLLATLCELANRTVTDAVHRFGTQSFVTLNVTSETS… |
| A0A820CC81 | 35-264 | None |
| A0A820CBI6 | 2-145 | None |
| A0A820C9R2 | 1-215 | None |
| A0A820A8A4 | 44-280 | None |
| A0A820A807 | 48-297 | None |
| A0A820CKX0 | 1-137 | None |
| A0A820B796 | 2-150 | None |
| A0A820DSX8 | 28-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.