DPCstruct | MC11401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15882 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0NF36 | 100-214 | ANVDRAFVADGQRTLCEQILHESDLIARFDFPDLFRDLFMEQVLLCALADAPLLEFTNPAWLGAIVSWQNGEGCFKYYGEEGDGVIG… |
| A0A816C9J4 | 20-131 | LKYLEDRYCTNIYHDAQTNFNNNDNQDLFLEQILLCSMIGYEEFIRLDWLKTILTWQDAESGCFSSASDAMESNIKMKRHLLIEQEM… |
| A0A0X3NFY8 | 29-166 | None |
| A0A2T7PYE8 | 281-404 | None |
| A0A2D4IZ80 | 6-100 | None |
| A0A7E5VHQ7 | 80-197 | None |
| A0A1I8IBP6 | 497-621 | None |
| A0A482VZG3 | 81-238 | None |
| A0A182MTM9 | 15-156 | None |
| A0A0V0J590 | 155-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.