DPCstruct | MC1140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 98 ± 18 aa |
| Standard deviation of domain lengths | 17.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12779 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J9HCU6 | 27-119 | LALATVGAAAAPLAASAEEVVIVAPSAPPPPRYEVVPAARVGYVWDRGHWDWHRGHYVWIAGHWQAERVGLHWAPGHWVARGPNWVW… |
| W8X0A9 | 1-74 | MAITLAPPPLPDVVQPVAPSPGYIWTPGYWAGGPNGYYWIDGAWLVPPAVGLLWPPGWWGWSDGYYRWHEGYWG |
| A0A1G6GWH8 | 44-152 | None |
| A0A3N4UDC4 | 33-127 | None |
| A0A0G2ZXS8 | 94-168 | None |
| A0A2R5E904 | 60-156 | None |
| A0A6P2E609 | 18-103 | None |
| A0A8A7VIC5 | 14-112 | None |
| A0A7V8FWZ5 | 52-159 | None |
| A0A7Y5KSI7 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.