DPCstruct | MC11395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 57.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P7TI93 | 1-128 | MHLSLQDITMRKAFRSSTIQDQQLFDRRTLPIPMQETFDLCEQPPPLNILTPYRSDSSPIVWLIYMDEFGNRDDGKEGLKFYTNPSY… |
| A0A3P8X512 | 88-184 | EELSLQDITMRKAFRSSTIQDQQLFDRTSLPIPLQETFQTCEQPPPLNILSPYRDDGKEGLKFYTDPSYFFDLWRKKMLQDTEDKRK… |
| A0A2I4CBT7 | 88-196 | None |
| A0A2W1BKY3 | 63-149 | None |
| A0A4Y2V3H2 | 1-93 | None |
| A0A6I9NDE3 | 70-165 | None |
| A0A2R8ZF51 | 1-92 | None |
| T1FWZ8 | 88-189 | None |
| H2N8D0 | 87-193 | None |
| A0A2G9TZS4 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.