DPCstruct | MC11392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 490 ± 62 aa |
| Standard deviation of domain lengths | 62.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 12.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3IEI0 | 2-550 | RYLQNHKIAVPVYEINSQISYQTIRKPTVFEKSLLQLLVKYRNKLGNQSIDQITQELKTDSVFFIEGLRYLMDYNAVEIMHGLSLDE… |
| A0A4P6K3T0 | 38-516 | EFRYPVQQQEVTIQVEQRRQMNLLEKFLLQAYTEIVPRPSLEELAGALGLDPLFLKNTLQDLISIQSMVHDVYGPRVTDEGKASLCS… |
| A0A3D8J5H4 | 9-408 | None |
| S3UBJ8 | 12-461 | None |
| A0A5P8WEQ0 | 15-446 | None |
| A0A177LMT6 | 105-603 | None |
| F8CQW7 | 3-482 | None |
| A0A562PUS4 | 65-754 | None |
| A0A7S7ZI68 | 2-402 | None |
| A0A2W5JZK8 | 310-786 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.